SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003337583.1.73186 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003337583.1.73186
Domain Number 1 Region: 222-315
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000335
Family Thioltransferase 0.055
Further Details:      
 
Domain Number 2 Region: 455-539
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000062
Family UBX domain 0.012
Further Details:      
 
Weak hits

Sequence:  XP_003337583.1.73186
Domain Number - Region: 11-50
Classification Level Classification E-value
Superfamily UBA-like 0.0014
Family UBA domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003337583.1.73186
Sequence length 590
Comment hypothetical protein PGTG_19124 [Puccinia graminis f. sp. tritici CRL 75-36-700-3]; AA=GCF_000149925.1; RF=representative genome; TAX=418459; STAX=5297; NAME=Puccinia graminis f. sp. tritici CRL 75-36-700-3; strain=CRL 75-36-700-3; AL=Scaffold; RT=Major
Sequence
MNSTNPDTLDDEAISSYLSFTNTTDIQAARNALQLANGNLEAAVEAYLDSTLHHPTPAGA
SLSNPDRSSYEQLSLDDSSQSDRNLIPISSPHLTTPAHSSGGRPSRPSRTFDSAPRPSRR
SSSKLLGFFFRLWIGPFRLIAIPVSFVADLGLTVFSLIGRLLGLRLPTMSFHWPRPSSFG
WSGPTPRTDPRTAAERWVRELEEELHARSSYTTAHPGDPVIPRLPEFLLLGYDDAVQKAR
DELKVLMVVLVSEEHDDVYQFKRGTLMDEELLNLLRTKDILVWGGDVKERDASFAAHVLD
ATTYPFVAFISLQAKRPSSTVTTITSSVNRSSSNVMSVCTRLEGSPERWTSSRSLITTIN
TVVIPRTNGYLSRLRTEKARREADRRLREEQDRAYAEAGRLDRERVMRKKAEMEAERKRL
EELQLREIVREKARQEKLEEAEQKRRWRYWARREKMPVEPSATDGVTIGFRLGNGRRVVR
KFRADAPLEALYLFVELESTSAAGTQDDSSAIPPARPSPDYRHTYSFKLSTAMPRRILPL
PEPPSPSSTTPQQVSIAQFGGLDGANVNVEGNVTEPSSDEDEEEDEDDEN
Download sequence
Identical sequences E3L9D9
PGTT_19124 XP_003337583.1.73186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]