SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003355245.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003355245.1.46622
Domain Number 1 Region: 301-599
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.57e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000228
Further Details:      
 
Domain Number 2 Region: 122-300
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.81e-44
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00043
Further Details:      
 
Domain Number 3 Region: 601-709
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.98e-25
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 4 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000567
Family TGS domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003355245.1.46622
Sequence length 718
Comment threonine--tRNA ligase, mitochondrial isoform X1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MGLYRRWRRLRLPGLQACGLHTAAVPTPPHWLVERLGFFEELWTAQVKKLASMAQKEHRA
IKVSLPGGRKVDAVAWNTTPYQLAQQISSKLADTAVAAVVNGEPYDLERPLEKDSDLRFL
TFDSAEGKAVFWHSSTHVLGAAAEQFLGAVLCQGPSTECGFYHDFFLGKERTVRGSELPV
LEQICQELAAAAQPFRRLEASRDQLRQLFKDNPFKLRLIDEKITGPKATVYGCGMLVDLC
RGPHLRHTGQIGGLKLLTNSSSLWKFSGTPETLQRVSGISFPTAEELRAWEEWREEAELR
DHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYTRRGFLEVKTPTLFSTK
LWELSGHWEHYREDMFALQPSGTDGPASSQSDHSTSHPTDTLALKPMNCPAHCLMFAHRP
RSWRELPLRLADFGALHRAEASGSLGGLTRLRCFQQDDAHIFCAPDQLEAEIRGCLDFLR
SVYTVLGFSFRLALSTRPSGFLGEPCLWDQAEQVLQQALEEFGEPWDLNPGDGAFYGPKI
DVHVRDALGRPHQCGTIQLDFQLPLRFDLQYKGQAEALERPVLIHRAVLGSVERMLGVLA
ESCGGKWPLWLSPFQVVVIPVGSEQEEYAREAQQSLRAAGLVGDLDADSGLTLSRRVRRA
QLAHYNFQFVVGQKEQSKRTVNIRTRDNHRLGERDLAEAVQRLLELQNTRVPNAEEIF
Download sequence
Identical sequences ENSSSCP00000022087 ENSSSCP00000022087 XP_003355245.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]