SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003404583.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003404583.1.64505
Domain Number 1 Region: 104-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000219
Family EGF-type module 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003404583.1.64505
Sequence length 208
Comment PREDICTED: proheparin-binding EGF-like growth factor [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MKLLPSVVLKLLLATVLSALVTGESLERIRRGVAAGTRKPDPPTGSTDQLLPSGDARSRE
VLDLDEANLDLFRVAFSSKPQAQATPSKEEYGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CRYVKKLRAPSCLCQPGYHGERCHGLTLPVENRLYSYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYNVENEEKVKLGMTNSH
Download sequence
Identical sequences G3T245
ENSLAFP00000007213 ENSLAFP00000007213 XP_003404583.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]