SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003404744.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003404744.1.64505
Domain Number 1 Region: 428-505,540-627
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.81e-50
Family SPRY domain 0.00016
Further Details:      
 
Domain Number 2 Region: 221-282
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.8e-18
Family B-box zinc-binding domain 0.00073
Further Details:      
 
Domain Number 3 Region: 7-52
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000125
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 4 Region: 180-212
Classification Level Classification E-value
Superfamily RING/U-box 0.0000431
Family IBR domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003404744.1.64505
Sequence length 630
Comment PREDICTED: E3 ubiquitin-protein ligase TRIM41 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELD
REEEEEEDGDEEEVEAVGAGGGWDTPMRDEDYEGDMEEEVEEEEEGVFWTNGMGGSNWDN
MDYVWEEEDEEEDLDYYLGNMEEDLRGEDEEDEEEVLEEDEEEELDPVTPLPPPPAPRRC
FTCPQCRKSFPRRSFRPNLQLANMVQVIRQMHPAPGRASRGNEQGICPKHQEALKLFCEV
DEEAICVVCRESRSHKQHSVVPLEEVVQEYKAKLQGHLEPLKKHLEAVQKMKAKEERRVT
ELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQLGRAGAAAIRLSDQAAQL
SRLLAEAQERSQQGGLRLLQDIKETFNRCEEVQLQPPEAWSPDPCQPHSHDFLTDAIVRK
MSRMFCQAARVDLTLDPDTAHPALMLSPDRRGVRLAERRQEVADHPKRFSADCCVLGAQG
FRSGRHYWEVEVGGRRGWAVGAARESTHHKEKVGSGGPSVGSGDASSSRHHHRRRRLHLP
QQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAH
IHTFSAAFLGERVFPFFRVLSKGTRIKLCP
Download sequence
Identical sequences G3T835
XP_003404744.1.64505 ENSLAFP00000009817 ENSLAFP00000009817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]