SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003404750.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003404750.1.64505
Domain Number 1 Region: 61-271
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-88
Family Calnexin/calreticulin 0.00000000246
Further Details:      
 
Domain Number 2 Region: 270-410
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.3e-59
Family P-domain of calnexin/calreticulin 0.0000000312
Further Details:      
 
Domain Number 3 Region: 412-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000174
Family Calnexin/calreticulin 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003404750.1.64505
Sequence length 593
Comment PREDICTED: calnexin [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MEGKWLLCMLLVLGTAAVQAHDGHDDDMIDIEDDLDDVLEEVEDSKSKPDTSTPASPKVT
YKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKG
LVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQF
HDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYT
LILNPDNSFEILVDQSVVNSGNLLSDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPDAV
KPDDWDEDAPAKIPDEEATKPEGWLDNEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPK
CESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPF
SAVGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEE
RPWLWVVYTLTVALPVFLVILFCCSGKKQPSAVEYKKTDAPQPDVKEEEEEKEEEKHKED
EEEEGEEKLEEKQKSDAEEDGGTASQEEEDRKPKAEEDEILNRSPRNRKPRKE
Download sequence
Identical sequences G3SLU9
XP_003404750.1.64505 ENSLAFP00000021441 ENSLAFP00000000430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]