SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003405207.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003405207.1.64505
Domain Number 1 Region: 196-377
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-50
Family DBL homology domain (DH-domain) 0.0000119
Further Details:      
 
Domain Number 2 Region: 385-511
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-30
Family Pleckstrin-homology domain (PH domain) 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003405207.1.64505
Sequence length 619
Comment PREDICTED: rho guanine nucleotide exchange factor 25 isoform X2 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MKPPDRPASGRTDRILGVMGGMLRACALPGQEGPPKRSPLGPGGTEPESDRTEGDQREER
EREAPDWALQPESYSIAGSEGSISASAASGLAAPSGPSSGLSSGPCSPGPPGPISGLRRW
LDHSKHCLSVETEMDGGQAGPYENWMLEPALATGEELPGLTLLTTLLESPRDKTQPAEEE
TASQASESEEEQKKAALERSMYVLSELVETEKMYVEDLGQIVEGYMATMAAQGVPENLRG
RDRIVFGNIQQIYEWHRDYFLQELQKCLEDPDWLAQLFIKHERRLHMYVVYCQNKPKSEH
VVSEFGDSYFEELRQQLGHRLQLNDLLIKPVQRIMKYQLLLKDFLKYYSRAGMDTEELER
AVEVMCFVPKRCNDMMTLGRLRGFEGKLTAQGKLLGQDTFWVTEPEAGGLLSSRGRERRV
FLFEQIIIFSEALGGGVRGGTQPGYVYKSSIKVSCLGLEGNLQGDSCRFALTSRGPEGGI
QRYVLQATDPAVSQAWIKQVAQILESQRDFLNALQSPIEYQRRESQTNSLGRPGGPGVGS
LGRPRPGDRAQVSTYTPINGSLPSLLLLPKGEVARAPLPLDTQTPSDIPQAPRDSPPVPP
ILNTPPCQARLAKLDEDEL
Download sequence
Identical sequences G3TBI9
ENSLAFP00000011346 ENSLAFP00000011346 XP_003405207.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]