SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003405785.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003405785.1.64505
Domain Number 1 Region: 138-407
Classification Level Classification E-value
Superfamily EndoU-like 4.19e-96
Family Eukaryotic EndoU ribonuclease 0.00000723
Further Details:      
 
Domain Number 2 Region: 21-62
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000405
Family Somatomedin B domain 0.0014
Further Details:      
 
Domain Number 3 Region: 90-129
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000103
Family Somatomedin B domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003405785.1.64505
Sequence length 412
Comment PREDICTED: poly(U)-specific endoribonuclease isoform X1 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MRACVPLIVAMLCGLAWAGTTESCASRCNEKFDRDAACQCDRRCPRHGDCCEDYEQLCTA
EENPKEPKAFLELEEETEEAPASNLYSAPSSCQGRCYEAVDKHHPCHCDARCQEFGNCCD
DFEILCGHEGFSHSSDAITKEELRSISEKIYKADTNKAQKADIVLNSQKRIPRSETRDRV
DCCPEPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQQLAEQDAFLREIMKTA
VMKELYGFLHHQNRYSSEQEFVNDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTG
FHNWIRFYLQEKEGLVDYYSHIYDGPWDSYPDVLAMQFDWDGYYKEVGSAFIGSSPEFEF
ALYSLCFIARPGKVCQLSLGGYPLAIQTYTWNKSTYGNGKKYIATAYVVSST
Download sequence
Identical sequences G3T0H0
XP_003405785.1.64505 ENSLAFP00000006463 ENSLAFP00000006463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]