SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003408758.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003408758.1.64505
Domain Number 1 Region: 75-290
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-59
Family DBL homology domain (DH-domain) 0.0000211
Further Details:      
 
Domain Number 2 Region: 275-399
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-33
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003408758.1.64505
Sequence length 1212
Comment PREDICTED: pleckstrin homology domain-containing family G member 3 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MPVSASLRQGGSQERPVSLTSTTSSSGSSRDSRGVMEEPNGTEASAENGAGSPRSRQAPN
SNNNSSSWLNRKVPLSPFNSRATAGHKLSYLGRVVREIVETERMYVQDLRSIVEDYLLKI
IDTPGLLKPEQVSALFGNIENIYALNSQLLRDLDSCNSDPVAVASCFVERSQEFDIYTQY
CNNYPNSVAALTECMRDKQQAKFFRDRQELLQHSLPLGSYLLKPVQRILKYHLLLQEIAK
HFDEERDGFEVVEDAIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTIYGEL
VLEGTFRVHRVRNERTFFLFDKALLITKKRGDHFVYKGHIPCSSLMLIESTRDSLCFTVT
HYKHSKQQYSIQAKTVEEKRTWTHHIKRLILENHHATIPQKAKEAILEMDSYYPNRYRYS
PERLKKAWSSQDEVSTHVHQGRRQSEPTRHLLRQLNEKARAGGMKGKGRSESEDPKGCRR
PSSQSPTNAEKRMSFESVSSLPEVELDPEPEAEREVFAAVEGPSTEEMPSDTESPEVLET
QFDAHQELLEMDHVGDMVDFVVAESSEDLKALSSEEEDDMGAIQEPESLLPPSVLDQASV
IAERFVSSFSRQSSVALEDGKSSGFTTPQLVSRSSSMLSLEGSEKGPAQHGSITDSLTSQ
LPSEVDTSLGVAAESSPSINGTQPPSPGCPAEPDRSSCKKKESLLSTRDRLLLDKIKSYY
ENAEHHDAGFSIRRRESLSYIPKGLVRNSVSRFNNLPRPDPEPVAPLGHKRQAGSRPASW
ALFDLPGPGQDPAPLTDAEFRPSSEIVKMWEGMESSAGSPQKGPGQGQANGFDLHEPLFI
LEEHELGAITEESTTASPESASPTERPSSAHLARELKELVKELSSSGQGELVAPLHPRIV
QLSHVMDSHMSERVKNKVYQLARQYSLRIKGNKSTMARPPLQWEKTVPERNGKSSTIPHL
QEGAGEPLGDKGKRKPLLSFLSYEQMMAQEHSPPKPYSARETSPRRLSFSPSAASPRTTS
PGIRPSGRSPLSPLDTETFNWPDVRELRSKYASHSEALPAESSRPRVVPVNRSHSVPENM
VEPPLRGRVSRCWSLNTKRGRGDEAAAQPQPPGSPLRDGLGGGEALHVTADLILENNLRV
IVMEKGPQPEGLEEGGGQGLSLLAAGLGQGQNLQESAEYLPKEEGPRDPADSSQQGRVRN
LREKFQALNSIG
Download sequence
Identical sequences G3T0P8
ENSLAFP00000006565 XP_003408758.1.64505 ENSLAFP00000006565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]