SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003410010.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003410010.1.64505
Domain Number 1 Region: 22-518
Classification Level Classification E-value
Superfamily Sema domain 1.01e-100
Family Sema domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1244-1369,1535-1691
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-34
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 859-951
Classification Level Classification E-value
Superfamily E set domains 0.000000000000369
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 4 Region: 950-1040
Classification Level Classification E-value
Superfamily E set domains 0.000000000000611
Family Other IPT/TIG domains 0.07
Further Details:      
 
Domain Number 5 Region: 521-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000968
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 6 Region: 1038-1111
Classification Level Classification E-value
Superfamily E set domains 0.0000042
Family E-set domains of sugar-utilizing enzymes 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003410010.1.64505
Sequence length 1759
Comment PREDICTED: plexin-D1, partial [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
PLCPLFLLLLLGAAQVGALEIQRRFPSPTPTNNFALDGAAGTVYLAAVNRLYQLSGANLS
LEAEAAVGPVADSPLCHAPQLPQASCEHPRRLTDNYNKILQLDPGQGLVVVCGSIYQGFC
QLRRRGNISAVAVHFPPAVPPAEPVTVFPSMLNVAANHPNASTVGLVLPPAAGAGGSRLL
VGATYTGYGSAFFPRNRSLEDHRFENTPEIAIRSLDARGDLAKLFTFDLNPSDDNILKIK
QGAKEQHKLGFVRAFLHPPDPRPNVQSYAYLALNSEARAGDKESQARSLLARICLPRGAG
GDAKKLTESYIQLGLQCAGGAGRGDLYSRLVSVFPARELLFAVFERPLGAPAAGAAPAAL
CAFRFADVQEAIHCARNACFVKPATDVVAVLDSVVQGTGPACESTRIIQLQPEQLDCGAA
HLQHPLSVLKPLKATPVFRAPGLTAVAVPSVNNYTVVFLGTVSGRLLKINLNESMQVVSR
RVVTVAYGEPVHHIMQFDPADPGYLYLMTSHQMARVKVATCDVHSTCEDCVGAADAYCGW
CTLETRCTLQQDCANSSQQHFWTSASEGTSRCPAMTVLPAEIDVRREYQGMILQLSGSLP
GLSGMEMACDYGNNIRTVARVPGPAFSHQIAYCNLLPRDRFPPFPPTQDHVNVEMSVRVN
GRNIVKTNFTIYDCSRIGQVYPHTACTSCLSTQWPCYWCTQQHACVSNQSRCEASPNLTS
PQDCPQILPSPLAPVPTGSSQNILVPLANASFFQGTALECSFGPEEIFEAIWVNESTVRC
NQVVLHTTQKSQVYPLSLQLKGRPAQFLDSPDPMMVEVYNCAMGSPDCSQCLGREDLGHF
CVWSDGCRLRGPLQPLPGSCPAPEIHLIEPLSGPLDGGTLLTVRGRNLGRRLRDVAHGVW
IGSVACEPLADRYTVSEEIVCATGPAPEPFSDVVMVNASKEGRSRERFSYVLPLVHSLEP
AMGPKAGGTRITIHGSHLDVGSELQVLVNDTEPCTDLMRAAASISCTAPGGALDAPVPVC
VRFERQGCARGNLTFRYMRNPVITAIRPQRSLVSGGRTITVAGERFHMVQNVSMAVHHIG
REPTIQVGNFNQTIATLQLGGSETAIIVSIVICSILLLLSVVALFVFCTKSRRAERYWQK
TLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSL
YEERYVLPSQTLNSQGSSPVQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVF
VHALEQQKDFVVRDRCNLASLLTVALHSKLEYYTSIMKELLVDLIDASAAKNPKLMLRRT
ESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWL
LRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDV
DLEWFASSTQSYVLRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVK
DLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAIL
SIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDID
KTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMT
PLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPAARRTQLQHK
FEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_003410010.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]