SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003413551.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003413551.1.64505
Domain Number 1 Region: 261-481
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-57
Family DBL homology domain (DH-domain) 0.000087
Further Details:      
 
Domain Number 2 Region: 471-618
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-18
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 3 Region: 625-683
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000024
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003413551.1.64505
Sequence length 704
Comment PREDICTED: rho guanine nucleotide exchange factor 16 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MSQRYSDSSLDEKLLEYRFHSELQLDANGNPACGLPMVRGSLRVRDRTTSEPEAPAPPED
IEPRPIVLSTQSPAALKMGTEQLIPRSLAVHSRAKAPARHQSFGAAMLSNEAVRRGPGLP
SGPSFSLDDLDVDAGSGGNLRRNLRNQSYRAAMKGPGTLGSEGGPTQLSPRLQALAEEPS
QPPARAQTKHKRTLGRKRAHKGSFKDDPQLYQEIRERGLNTSHESDDDGLEDNASLNGPQ
RVDTTIVVKSYRPAQITWSQLPEVVELGILDTLPAEERKRQEAIFEILTSEFSYQHSLGV
LVAEFLKSKELRATVTQTEHHHLFSNILDVLGASQRFFEDLEQRHKEQVCVEDISDILEE
HAEQHFHPYVVYCSNEVYQQRTLQRLLSSNAAFREALQEIERRPACGGLPMISFLILPMQ
RVTRLPLLTDTLCLKTQGHPERYKAASRALKAISKLVKQCNEGARRMERTEQMYTLNKQL
DFGKIKSLGLISASRWLLKRGELSLVEDAGLFRKIASRPTSYLFLFNDVLLVTKKKSEDS
YAVQDYAQIEHIGVQKIEPSDLPLPGGSNRTSTVPYTFLVTMLHNSEGRQEQILLSADSA
SDRARWITALRHREKQWQDHANKGDLLQVEVTKAYFAKQADEVSLQQADVVLVLEKEDGW
LYGERLRDGETGWFPEDFARSITSRVAVEDNMRRMERLRVETDV
Download sequence
Identical sequences G3T4Y3
ENSLAFP00000008441 XP_003413551.1.64505 ENSLAFP00000008441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]