SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003413738.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003413738.1.64505
Domain Number 1 Region: 312-437
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000601
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  XP_003413738.1.64505
Domain Number - Region: 39-91
Classification Level Classification E-value
Superfamily HR1 repeat 0.00254
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003413738.1.64505
Sequence length 564
Comment PREDICTED: rhotekin isoform X1 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MFARNHRSRVTVARGSALEMEFKRGRFRLSLFSEPPEDTELQRKLDHEIRMREGACKLLA
ACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLGKTARRPSDSGPPADRSPCRGR
VCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGEHIEDTEMVLVDRTLTDITFQNSV
LFADAGPDFELRLELYGACVEEEGALTTAPKRLATKLSSSLGRSSGRRVRASLDSAGGSG
SSPILLPTLAVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLTSHEENPAWLPLYGSVCCRL
VAQPLCMTQPTASGTLRVQQAGELQSWAQVHGVLKGTNLFCYRRPEDTDTGEEPLFTIVI
SKDTRVRAGELDQAPGRPFTLSISNQYGDDKVMHTLQTESRGALQSWMEALWQLFFDMSQ
WKQCCDEIMKIETPAPRKPPQAVAKQGSLYHEMAIEPLDDIAAVTDILAQREGPRLETPP
PWLAMFTDQPALPSPCSPASVAPAQARTHPLLWGRPRTFSLDAVPPDHSPGASRSVAPLP
SQRSPRSRGLCSKGPPHTWLQSPV
Download sequence
Identical sequences G3T0Z3
ENSLAFP00000006697 XP_003413738.1.64505 ENSLAFP00000006697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]