SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003414347.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003414347.1.64505
Domain Number 1 Region: 18-187
Classification Level Classification E-value
Superfamily RUN domain-like 1.83e-40
Family RUN domain 0.00077
Further Details:      
 
Domain Number 2 Region: 533-646
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-18
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Domain Number 3 Region: 684-790
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000149
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  XP_003414347.1.64505
Domain Number - Region: 999-1056
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0389
Family PHD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003414347.1.64505
Sequence length 1062
Comment PREDICTED: pleckstrin homology domain-containing family M member 1 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MLSVVENGLDPRAAIPVIKKKLVGSVKALQKQYVSSDTVVTSEDGDANTMCSALEAVFIH
GLHAKHIRAEAGGKRKKSAHQKPLPQPVFWPLLKAVTHKHIISELEDLVFVNTDVGRCRA
WLRLALNDGLMECYLKLLLQDQARLCEYYQPTALLRDAEEGEFLLSFLQGLTSLSFELSY
KSAILNEWTLTPLALSGLCPLSELDPLTTSGTELQRKESLDSISHSSGSEDIEVQHSGHK
IRRNRKLTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPDRSEEPMSCDSDLGTANAD
GSDRSLQEVLSEFSKAQVNSVPTNGLSRETEASALQASLSFHGLDTSTHLHLDVLAEPLP
AQASSRTPDGDHKQEPLSQKPGILDLPQLSTAQTTPSGDTSAQKPSGPVREKTRAVRQGS
GPEKTLAGDRVGLNLVVSSPTSPKSKSWISEDDFYRPPQEPPPESPSDHSIASSKGTPGS
RPGLHRHFSLGPRKSHSMGDLDRVPSPGSRKTKAAPEQEHKNFRVVHRRQMGLSNPFRGL
LKLGTLERRGAMGIWKELFCELSPLEFRLYLSDKERTCVENCSLLRCESVGPAHSDGRFE
LVFSGKKLTLRASSQDEAEDWLDRVQEALHKYRPQQEDEWVNIQYPEQPEDLPEAPQGGL
PSHSNALSEPESFQGTQFDWSSAHVPEPDAIKESLLYLYSDRVWAPYIFSLSLESLKCFR
VRNNEKILSDSHGVETIRDILPDTSLGGPSCFKIITAKAVLKLQARNAEEAALWRDLVRK
VLASYLETAEEAVTLGGSLDENCQEVLKFATRENGFLLQYLVAIPTEKGLDSQGCFCAGC
SRQIGFSFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKRPICRQALKFLTQIW
AQPLINLQLVNASLYEHVEQMQLIGRSREQLKLLGDYLGLCRSGALKELSKRLNYRNYLL
EFPHKYSIADLQQIAEGVYEGFLKTLIEFASQHVYNCDLCTQRGFICQICHHHDIIFPFE
FDTTVRCAECKTVFHQSCQAVVKKGCPRCARRRKYQEQSILT
Download sequence
Identical sequences G3TLQ5
ENSLAFP00000015884 ENSLAFP00000015884 XP_003414347.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]