SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003418537.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003418537.1.64505
Domain Number 1 Region: 335-431
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 494-785
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000000000034
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 81-133
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000887
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 257-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000463
Family I set domains 0.05
Further Details:      
 
Domain Number 5 Region: 179-247
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000265
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003418537.1.64505
Sequence length 847
Comment PREDICTED: follistatin-related protein 5 isoform X1 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MFKCWSAVLVLGFIFLESEGRPPKEAGYVLKSYQPLVRLRHKQEKSQESSRTKGFLIQDG
PFGSCENKYCGLGRHCVISRELGRAECACMELCKRHYKPVCGSDGQFYENHCEVHRAACL
KKQKITIVHNEDCFFRGDRCETAEYSKMKNMLLDLQNQKYITQENENPNSDAIARKKILV
DQMFKYFDADNNGLVDINELTQVIKQEEFSKDLSDCTLYDLLKYEDFNSDKHLALEEFYR
AFQVIQLSLPEDQKVSVTAATVGQSAVLSCAIQGALRPPVIWKRNSIILNNLDLEDINDF
GDDGSLYITKVTTTHMGNYTCYAEGYEYVYQTHIFQVNVPPVIRVYPESQAREPGVTASL
RCHAEGIPNPQLSWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIAKNEAG
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSE
KLLGFQEEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVVQAVST
DPVPVKLHYDKSHDQVWVLSWGTMDKTSPTLEVITLAGGNVAHHTIHTQPVGKQFDRVDD
FFIPTTTLLITHMRFGFILHKDEAALQKIDLETMSYMKTINLKDYQCIPQSLAYTHLGGY
YFIGCKPDSTGAIPPQLVVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDMKGIVRVQY
ITIRGEIQEAFDIHTNLHISDVAFQPSFTEANQYNIYGSSSMQTDVLFVELASGKVKMIK
SLKEPLKAEDWLWNRKNRQIQDSGLFGQYLMTPSKNSLFILDGRLNKLNCEITEVEKGNT
IIWVGDA
Download sequence
Identical sequences G3SWU7
ENSLAFP00000004827 ENSLAFP00000004827 XP_003418537.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]