SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003420826.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003420826.1.64505
Domain Number 1 Region: 147-461
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-100
Family Protein kinases, catalytic subunit 0.0000000000174
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 2.23e-24
Family Pleckstrin-homology domain (PH domain) 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003420826.1.64505
Sequence length 481
Comment PREDICTED: RAC-beta serine/threonine-protein kinase isoform X3 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MNEVSVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKRERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMQAIQMVANSLKQRGPGEDPM
DFKCGSPSDSSTAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQR
KLLPPFKPQVTSEIDTRYFDDEFTAQSITVTPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
Download sequence
Identical sequences G3SRC6
ENSLAFP00000002428 XP_003420826.1.64505 ENSLAFP00000002428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]