SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003433821.2.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003433821.2.84170
Domain Number 1 Region: 6-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.83e-76
Family BAR domain 0.0057
Further Details:      
 
Domain Number 2 Region: 392-571
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000166
Further Details:      
 
Domain Number 3 Region: 265-365
Classification Level Classification E-value
Superfamily PH domain-like 1.4e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 704-759
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-17
Family SH3-domain 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003433821.2.84170
Sequence length 760
Comment PREDICTED: rho GTPase-activating protein 26 isoform X3 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLIGALKNLSLAKRKF
ADSLNEFKFQCIGDAETDDEMCIARSLQEFATVLRNLEDERIRMIENASEVLITPLEKFR
KEQIGAAKEAKKKYDKETEKYCGILEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLE
YVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFSDFKTELTISIQNTRNRFE
GTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITM
VPFDQKSGGKGGEDESVTLKSCTRRKTDSIEKRFCFDVEAVDRPGVITMQALSEEDRRLW
MEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIKKCIHAVETRGINEQGLYRIVGVNSRV
QKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLE
NQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQ
EETVAAIMDIKFQNIVIEILIENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERP
LTLFHAMQSAEKQEQRNSIINSSLESVVSSNANSILNSSSSLQPNMNSSDPDLDVLKPAR
PKSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPISTPFRKAKALYACKAEHDSE
LSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL
Download sequence
Identical sequences F1Q2M8
ENSCAFP00000009426 ENSCAFP00000009426 XP_003433821.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]