SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003438246.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003438246.1.78416
Domain Number 1 Region: 12-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.31e-74
Family BAR domain 0.000000049
Further Details:      
 
Domain Number 2 Region: 282-346
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-23
Family SH3-domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003438246.1.78416
Sequence length 349
Comment PREDICTED: endophilin-A2 isoform X2 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MSVAGFKKQIYKATQLMSEKVGGAEGTKLDEDFKDLERKADITSKAVVEVLNKTSEYIQP
NPATRAKLSMLSTVSKIRGQVNSPGYPQAEGLLGECMTKYGHEMGENSNFGGALIDAGES
MKRLAEVKDALDIDVKQNFIDPLQGIAEKDIKDIQFHLKKLEGRRLDYDYKKKRQGKIQD
EEIRQALEKFHESKELAERSMYNLLETDVEQVSQLSSFVESLLQYHRQATQIMEELSDKL
RERVNDAQSRPRQEYTPKPKPAFDFGEVEHSNGGYSSSASSPPAYSSAEPCCKAMYDFEP
ENDGELGFQEGDIIKLVSQIDENWYEGSLRGKSGYFPTNYVEVMVPLPH
Download sequence
Identical sequences I3JVI5
XP_003438246.1.78416 ENSONIP00000012880 ENSONIP00000012880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]