SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003442039.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003442039.1.78416
Domain Number 1 Region: 26-188
Classification Level Classification E-value
Superfamily RUN domain-like 2.22e-44
Family RUN domain 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003442039.1.78416
Sequence length 433
Comment PREDICTED: RUN domain-containing protein 3A isoform X2 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MESGCIQTAMAMGLTSKKASARSVCVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFIN
FAAILEHILSHRFKGSGSWFSSDGQRSFWEYIRLACSKVQNNCITSIENIENISTSRAKG
RAWIRVALMEKRLSEYVSTALRDTRTTRRFYDDGAIMLREEATVLTGMLIGLSAIDFSFC
LKGETLDGKSPAVIDYTPYLKFTQSYDYLSDEEDRRSVDSSNSEESVPEHPYIPLVTDEE
SWSNKCRKMEQRFKIVYAQKGYLEELVRLRESQLKNVETENKRLRAKVEELTVQSQQEKK
ELEAIVLELQAQLSALMPCDSSHLAKDLSIPLINQWSTITNNQGDVKLFRRRSFHSLEQL
SAEVSLNSDSQKTDGRQNGDAAWTSAGKDNTPSMLGLCGSLASLPSSKSLASLKSSECLV
NISTEPSPALSPS
Download sequence
Identical sequences I3IWF3
ENSONIP00000000943 ENSONIP00000000943 XP_003442039.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]