SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003443189.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003443189.1.78416
Domain Number 1 Region: 120-375
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.46e-68
Family Nuclear receptor ligand-binding domain 0.00000728
Further Details:      
 
Domain Number 2 Region: 51-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-30
Family Nuclear receptor 0.0000751
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003443189.1.78416
Sequence length 404
Comment PREDICTED: nuclear receptor subfamily 2 group F member 5 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MAMVVNQWPENISADPGSQLQICGQEPGGAPGTPNGSTPGNDALSGDKIPNVDCMVCGDK
SSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRGNRDCPIDQHHRNQCQYCRLKKCLKVGMR
REAVQRGRTSNSQSSPGQYLTNGTDPYNGQPYLSGFISLLLRAEPYPTSRYGAQCMQGNN
LMGIENICELAARLLFSAVEWAKNIPFFPDLQLMDQVALLRMSWSELFVLNAAQCSMPLH
VAPLLAAAGLHASPMSAERVVAFMDHIRVFQEQVEKLKALQVDTAEYSCLKSIVLFTSDA
MGLSDVAHVESIQEKSQCALEEYVRNQYPSQPNRFGRLLLRLPSLRIVSSPVIEQLFFVR
LVGKTPIETLLRDMLLSGSSYNWPYMPTVQRERPISLHYNENGP
Download sequence
Identical sequences I3JPL0
XP_003443189.1.78416 XP_004568636.1.88231 XP_005744124.1.53837 XP_005923742.1.24487 ENSONIP00000010804 ENSONIP00000010804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]