SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003445109.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003445109.1.78416
Domain Number 1 Region: 120-392
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-65
Family Nuclear receptor ligand-binding domain 0.0000089
Further Details:      
 
Domain Number 2 Region: 52-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-29
Family Nuclear receptor 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003445109.1.78416
Sequence length 407
Comment PREDICTED: nuclear receptor subfamily 2 group F member 6 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MAMVSGGWGNPNGGANGLGEKAYLRRGEDEEGSPRAGSSDVDVGDEDKACVVDCVVCGDK
SSGKHYGVFTCEGCKSFFKRSIRRNLSYSCRSNRECQIDQHHRNQCQYCRLKKCFRVGMR
KEAVQRGRIPPSHSGISPNSLAGGVAGVVPGHIGADYFNGQPVSELISQLLRAEPYPPSR
YGAPYGQAQMQASASGASVMGIDSICELAARLLFSTIEWARNIPYFPELPVSEQVALLRL
SWSELFILNAAQSALPLHMAPLLAAAGFHSSPMSAERVVSFMDQVRVFQDQVEKLNRLQV
DSAEYSCLKAIALFSPDACGLTDPAHVESLQEKAQVALTEYERLQYPNQPQRFGRLLLRL
PALRAVPANLISQLFFMRLVGKTPIETLIRDMQLSGSSISWPYAPGQ
Download sequence
Identical sequences I3JV12
ENSONIP00000012707 XP_003445109.1.78416 ENSONIP00000012707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]