SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003446160.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003446160.1.78416
Domain Number - Region: 64-152
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000837
Family Hemolysin E (HlyE, ClyA, SheA) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003446160.1.78416
Sequence length 410
Comment PREDICTED: Golgi membrane protein 1 isoform X1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MGGLGNGRRGGRSPPLMIAALIACILVLGFNYWVSSSRNLELQTKLYELEGQVRRGAAER
GADEMKKKEFEQEIQKQKDQISNIQSLYKRQLEGAENTCSQHKATLQQNISSSAKTIQEL
KGQLNRLNDALGKLEKDLQSCQGNINTLNNKLMYDMTQCNAQVLSQKELCDERVAAAKLE
ADKKMQKLIHTPVSSQQENVGGVEINKSVKALSDGIPATASSQTPSLSQLKGNKVHELLT
NEIMVDIVPSAPVEQPTSKDLSKAGPKSVPSAAALKQEDKQPQEGADKADEVEGETGKLV
ENNLTEDKENEAMNAHEEDPQIEEADPGMEGMLIGRGKADETQDGQKLQEPEEYDADEQV
VGGEDLEKPQENKQDENIDKVMEDELADYNGDDENEGEFEADKQAELAQN
Download sequence
Identical sequences I3KCK8
XP_003446160.1.78416 ENSONIP00000018853 ENSONIP00000018853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]