SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003446987.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003446987.1.78416
Domain Number 1 Region: 532-788
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-62
Family Nuclear receptor ligand-binding domain 0.0000000143
Further Details:      
 
Domain Number 2 Region: 437-525
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-22
Family Nuclear receptor 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003446987.1.78416
Sequence length 803
Comment PREDICTED: glucocorticoid receptor isoform X1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MDQGGLKRNGNRDDGLTFAEIGGTGDTPGSLFQSAMHLPGSLPPATVAPNRQGGTNGQGE
LGGLFESHQHHVLGEGTDMKESKMIRMQKQQQQQQQDIGIFGMGDSLPLFNQCISDTPTS
VINTSDTSVLGNLPLPDLFSHPIKTESILSLDKDLGTYSGHTGTGLCDLDGNSGRLIEDT
EIWQDLDLPSSLPEISAFELDSEVAHLDNILQESAGGGCPVSGLPKEIKPLMGNGENCTS
VNGTEQQHHALHPHQQQQQQQHHQLIHHQQHQPQHHQPQALLSTVIIKEEKDPDESFIQI
CTPGVIKQEKQDSAFCQPQCLQSSISSLQGGGPGPMSSPVGVGAVPGYHYRANPSSTMGI
QDQKPFDMYSNMPLMGDGWARGKRYGETSGIQSSDDGLTPVASLAPFSVGFSSSSPREGE
ISSSVVPAQSKTSGQTHKICLVCSDEASGCHYGVVTCGSCKVFFKRAVEGWRARQNTDGQ
HNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKNKKLIKMKVHRAGASEPTIS
NMPVPVVPRSMPQLVPTMLSILKAIEPEIIYSGYDSTLPDTSSRLMSTLNRLGGQQVVSA
VKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFSLGWRSYEQCNGSMLCFAPDLVINKDRM
KLPFMTDQCEQMLKICNEFVRLQVSYEEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMTYI
KELGKAIVKREENPSQNWQRFYQLTKLLDSMQEMVEGLLQICFYTFVNKTLSVEFPEMLA
ELISNQIPKFKDGSVKALLFHQK
Download sequence
Identical sequences I3JP68
ENSONIP00000010662 ENSONIP00000010662 XP_003446987.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]