SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003455739.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003455739.1.78416
Domain Number 1 Region: 16-362
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-120
Family Motor proteins 0.0000000000278
Further Details:      
 
Weak hits

Sequence:  XP_003455739.1.78416
Domain Number - Region: 699-822
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0863
Family HBL-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003455739.1.78416
Sequence length 1063
Comment PREDICTED: kinesin-like protein KIF11 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MSSNVQSGGKREEKGRNIQVVVRCRPFNTMERKSSYGVIDCDQNRKEVMVRTGGMNDKAS
RKTYTFDMVFGPSAKQIEVYRSVVCPILDEVIMGYNCTVFAYGQTGTGKTFTMEGERSPD
EQFTWEEDPLAGIIPRTLHQIFEKLSENGTEFSVKVSLLEIYNEELFDLLSPTEDVSERL
QLFDDPRNKRGVVVKGLEEVTVHNKDEVYQILERGAAKRRTASTLMNAYSSRSHSVFSVT
IHMKEITLEGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITAL
VEKRPHVPYRESKLTRILQDSLGGRTKTSIIATVSPSSSNLEETLSTLEYASRAKNIMNK
PEVNQKLTKRTLIKEYTEEIERLKRDLAATRDKHGVYLSSENYESMVAQITAHEEQITEY
NDKIAIMEEELKKVTELFVDSKARLEQCTADLDEKQQRLEETSRDLQETKVKLSEEEFIC
SELSSVQETLYDTAGQLLSTADASTSDVSGLHDKLDRKKKVEEHNREIQQSFAQQMEGSF
RDVQRCIQQHGDKQRHMLSSYSQAVDGLLMMNEAALKGALTTVESFVGGVRPLVAESVAR
CEEKVQQNEMLCLQDKESVLQLLEEHRRDMEEVLVVQTLMGLSAAKELNDSLRASVEKQR
ALADKAEAMKEMGVVFDSLVRELAALREATVQSLSALQAERNELEDKIRQAEEEIEQKDM
KETIQCLQDQLNLLTVKVKKKFTGLYSASRGLQKPLQSLQEDISRGCSTVEHQVSAQADL
LSSSASSLISSLRLTADESQQSLEEMSGCCSHIHSSVTGLLERDLEWSSRVKEHAEKRAE
EQLTLMRKVGSEAQDLRQSVEDRCSEQLRAAKVEISNHQQEVTRALTAVKDQTSIDWSAL
HEQRAELLQHVEASEQLVHSFLRDELQEDVPTGATPQRREFVYPRQLVKSRRRSELLESL
RRQQEELQAAMEAEEEEELEDEDKQSQTDPDSLEDDLSTCNESLATEPSFIDENLVFNES
KRVPFFKKKKGKKETKIPSRSKVSENEAESTPQRSRLPLRCQN
Download sequence
Identical sequences I3KEB0
XP_003455739.1.78416 ENSONIP00000019455 ENSONIP00000019455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]