SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003458081.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003458081.1.78416
Domain Number 1 Region: 395-565
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-52
Family SPRY domain 0.0004
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-18
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 3 Region: 143-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.33e-17
Family B-box zinc-binding domain 0.00067
Further Details:      
 
Weak hits

Sequence:  XP_003458081.1.78416
Domain Number - Region: 217-298
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0497
Family HBL-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003458081.1.78416
Sequence length 573
Comment PREDICTED: tripartite motif-containing protein 16 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MADHTSPDYFSCSLCQNLLRDPVAIPCGHSFCMDCISGYWNEADYTGIYICPQCKITFTQ
RPVLRPNATLSMVAEKIKKSGLNLNLSTSQGSVFAGSNDVPCDFCIGKKLKAVKSCLNCL
ASYCEKHLKPHYESTTFKRHKLVDELGNLDRKICPQHQKSLELFCRTDQMCICAICTVSE
HRGHDIVSAEAERGEKQKLLGVSQAEIKQKCQERVKELEELKTAVDSLKNSAHRAMVESQ
KMFEDMIRSIERMRSEVSKLIGINEKAAFSQSEALIERLEQEIDELKKKESGLKQLYSTE
DHIHFLQNFNYLCTPTDDGFIPRVTVNPDFSFAAVRKAVAEIKERLEEFGREELLRISKS
VNEVPVYTTESRTLDRRSRGKEMTVDNTPPEPKTRADFVKYFCQLKLDHNTAYKELYISE
NSRKVIRTRELQPYGDNSERFDSFAQVLCREALSGGRFYWEIEWNGEFSIGVAYKSISRK
GKGSLCLLGYNDKSWSLLCSDSGYSAWHNRVDKPANGPHSPRIGVYLDHTAGVLAFYSIG
NTMTLLHRFETKFVEPLYPGFGVGTSVRICNVK
Download sequence
Identical sequences I3KLU5
ENSONIP00000022090 XP_003458081.1.78416 ENSONIP00000022090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]