SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003458820.2.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003458820.2.78416
Domain Number 1 Region: 367-553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-61
Family SPRY domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 14-83
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-19
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Domain Number 3 Region: 151-215
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000458
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003458820.2.78416
Sequence length 569
Comment PREDICTED: E3 ubiquitin-protein ligase TRIM39 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MSTQTVTNMASVPLENQFRCCICLDTYTDPVSIPCGHNFCLDCIEGYWDTKDRSECPLCK
ETFKERPELRINRAFSDMIEFFKRSLSPTLMQGEDVEPAHQLSDREDVPCDVCHGNKAPS
VKSCLVCQASYCEIHLVPHQRDPALQRHRLTDPAIFNTSHLCRKHNKPLTMFCKQDHTPV
CSKCTEGDHKHHKIVPMEKESRRVKMNLRETKSDIQQMIQARLKKMEDIKSSVDLSKRAT
EREIQSSSQVCSTLITAIERQQAELAKDLEERQLEAERKAEELLEELEKEIHELQTRSSE
LQHLELTRSSLHLLQSFPSLSRLPATREWSEVAVHSDNSAGMVRRAVSMLGDMCQEVANK
LSAEEVDKISAYAVNVTLDPETASGWLVLSPDKKKVSLASQKKKTPLPDSPQRFDSCVCI
LGKQSFTSGRRYWVVQVGDKTDWDLGVAQESINRKGAITVRPENGYWAICRRKGGSLSAC
AGPSVTLNLHEIPKKVSIFLNYEEGSVSFYDAEAKTHIYTYGGCSFSEPLFPYFNPCVQN
SGRNVAPLVICPLEGDVREEQDTGIDLTV
Download sequence
Identical sequences I3IUV5
ENSONIP00000000395 XP_003458820.2.78416 ENSONIP00000000395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]