SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003459909.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003459909.1.78416
Domain Number 1 Region: 50-174
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-21
Family Synaptotagmin-like (S variant) 0.041
Further Details:      
 
Domain Number 2 Region: 223-272
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000128
Family CUE domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003459909.1.78416
Sequence length 275
Comment PREDICTED: toll-interacting protein isoform X1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MATTISTQRGQVYIGELPQDFLRITPTQQQQQVQLDAQAARQLQYGGSISTVGRLSITVV
QAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHVTIPEGLREGRVVDEWFSLSGRQGDDKEGMINLVMSFTSLPAGVM
TQPVVFMPSVYQQGVGYVPITGVPAVYNQGMMPMAVPTTMPAIGNQGLPCTEQDLKALQD
MFPNLDKEVVRTVLDAQQGNKDAAINSLLQMAEEL
Download sequence
Identical sequences I3JNL7
ENSONIP00000010461 ENSONIP00000010461 XP_003459909.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]