SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003461392.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003461392.1.53824
Domain Number 1 Region: 59-117
Classification Level Classification E-value
Superfamily Kringle-like 7.71e-19
Family Fibronectin type II module 0.0036
Further Details:      
 
Domain Number 2 Region: 178-223
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000223
Family Fibronectin type II module 0.002
Further Details:      
 
Domain Number 3 Region: 27-71
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000628
Family Fibronectin type II module 0.0023
Further Details:      
 
Domain Number 4 Region: 118-169
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000203
Family Fibronectin type II module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003461392.1.53824
Sequence length 223
Comment PREDICTED: epididymal sperm-binding protein 1 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MTQWSSYLLGWMTFLLYFYETSGQLNENCVFPFIYKGSIYFTCTKINSFLPWCSTRAVYD
GRWKYCLIEDYPRCVFPFIFRGKTRNSCISDGSLTGKMWCSVTSSFDEKQQWKYCEMNEY
GGNSFSKPCIFPSKYRNSVISECLEDNSNKLWCPTTEDMDKDGKWSFCADTRLSSSGPGF
PCHFPFNYKNKNYFNCTNKGSKNNLTWCATSYNYDQDHTWVYC
Download sequence
Identical sequences ENSCPOP00000010748 XP_003461392.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]