SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003464273.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003464273.1.53824
Domain Number 1 Region: 194-427
Classification Level Classification E-value
Superfamily PH domain-like 9.96e-87
Family SSRP1-like 0.00000495
Further Details:      
 
Domain Number 2 Region: 539-619
Classification Level Classification E-value
Superfamily HMG-box 1.07e-25
Family HMG-box 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003464273.1.53824
Sequence length 709
Comment PREDICTED: FACT complex subunit SSRP1 isoform X2 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MAETLEFNDIYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNVQAGELTEGVWRRVALGH
GLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLS
FDIGDQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEA
FAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVL
RLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMSEEEVEKRFEG
RLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGFI
YVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNA
KKLNIKNRGLKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDE
SFNPGEEEEDVAEEFDSNASASSSSNEGDSDREEKKRKQLKRAKMTKDRKSRKKTVEAKK
GKDPNAPKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKA
EDARREYEKAMKEYEGGRGESSKRDKSKKKKKVKAKMDKKSTPSRGSSSKSSSRQLSESF
KSKEFVSSDESSSGENKTKKKRRRSEDSEDEELASTPPSSEDSASGSDE
Download sequence
Identical sequences H0UU14
ENSCPOP00000000423 10141.ENSCPOP00000000423 ENSCPOP00000000423 XP_003464273.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]