SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003465323.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003465323.1.53824
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 2.35e-50
Family Globins 0.000000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003465323.1.53824
Sequence length 147
Comment PREDICTED: hemoglobin subunit beta [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MVHLTAAEKSAILDLWGKVNVGEIGAEALGRLLVVYPWTQRFFEKFGDLSSASAIMSNAH
VKSHGAKVLASFSEGLKHLEDLKGTFAKLSELHCDKLHVDPENFRLLGNMIVIALAHHHP
SEFTPCTQAAFQKVTAGVANALAHKYH
Download sequence
Identical sequences H0UWE7
ENSCPOP00000001378 ENSCPOP00000001378 XP_003465323.1.53824 10141.ENSCPOP00000001378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]