SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003467415.2.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003467415.2.53824
Domain Number 1 Region: 270-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000557
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 907-959
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000474
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 743-789
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000367
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 405-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000102
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 964-1013
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000144
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 874-915
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000279
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 781-839
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000567
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003467415.2.53824
Sequence length 1243
Comment PREDICTED: zinc finger protein ZFAT [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
METQAAENTAIFMCKCCNLFSPNQSELLSHVSEKHRDEGVNADDIIIPLRPLSTPEPSNP
SKEGDEFLVMKRKRGRPKGSTKKPSVEEELAENTASPSENGKLAPEEGSGLAPSSLECSK
CCRKFSNPRQLRKHICIIVLNLGEEEGEAGNESDLELEKKYKEDDREKAPKRPRSQKTEK
VQKISSGKEARQLSGTKKPIISVVLTAHEAIPGATKIIPVEAGPPETGAANPETSAVDLV
PRRGYQEYAIQQTPYEQLMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPY
KCPQCSYASAIKANLNVHLRKHTGEKFSCDYCSFTCLSKGHLKVHIERVHKKIKQHCRFC
KKKYSDVKNLIKHIRDTHDPQDKKVKEALDELRLMTREGKRQLLYDCHICERKFKNELDR
DRHMLVHGDKWPYACELCGHGATKYQALELHVRKHPFVYVCAICLKKFVSSIRLRSHIKE
VHGAAQEALVFTSSINQSFCLLEPGGDIQQEALGDQLQLVEEEFVCREVDALKEEAGPED
TRCEEEQKELEVPVELPAPEMPLASPQAESDALPPCELETTVVSADLHSLAVVSDDFLLK
NDTSSTEAHAAAEKNLDSQHEGSAQTQGEEIMLLLSKTKSPRPAPETQSAKSPPNEGQQV
TSLPACEPDPSRCLRPNPTEASDLLPPVASVGDTDVHQPDFCKPASEHQPGSTAFMKVLD
SLQKKQMNPGLCERIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLYYCSQCHYSSI
TKNCLKRHVIQKHSNILLKCPTDGCDYSTPDKYKLQAHLKVHTELDKRSYSCPVCEKSFS
EDRLIKSHIKTNHPEVSMSTISEVLGRRVQLKGLIGKRAMKCPYCDFYFMKNGSDLQRHI
WAHEGVKPFKCSLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHT
ADGKQFKCTVCDYTAAQKPQLLRHMEQHASFKPFRCAHCHYSCNISGSLKRHYNRKHPSE
EYANVGSVELAAEALIQQGGLKCPVCSFVYGTKWEFNRHLKNKHGLKVVEIDGDSKWEST
AETPEEPSTQYLHITEAEEDVQGTQAAVAALQDLRYTSESGDRLDPTAVNILQQIIELGT
ETHDAAAVASVVAMAPGTVTVVKQVTEEEPSSNHTVMIQETLQQASVELAEQHHLVVSSD
DVEGIETVTVYTQGGEASEFIVYVQEAMQPVEEQAGEQPAQAL
Download sequence
Identical sequences A0A286XTY2
XP_003467415.2.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]