SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003468708.2.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003468708.2.53824
Domain Number 1 Region: 53-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.19e-46
Family Regulator of G-protein signaling, RGS 0.00000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003468708.2.53824
Sequence length 181
Comment PREDICTED: regulator of G-protein signaling 5 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPEKPAKIQKPSADEALQ
WRDSLDKVLQNSYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKEIYEEF
IQTEAPKEVNIDHFTKDVTMKNLMEPSLNSFDMAQKRIHALMEKDSLPRFVRSEFYQELV
K
Download sequence
Identical sequences A0A286Y1Q3
ENSCPOP00000010042 ENSCPOP00000010042 XP_003468708.2.53824 10141.ENSCPOP00000010042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]