SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003469421.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003469421.1.53824
Domain Number 1 Region: 504-654
Classification Level Classification E-value
Superfamily EF-hand 4.13e-51
Family Osteonectin 0.00000215
Further Details:      
 
Domain Number 2 Region: 451-501
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000804
Family Ovomucoid domain III-like 0.00068
Further Details:      
 
Weak hits

Sequence:  XP_003469421.1.53824
Domain Number - Region: 422-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family Follistatin (FS) module N-terminal domain, FS-N 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003469421.1.53824
Sequence length 655
Comment PREDICTED: SPARC-like protein 1 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MKTVPFLLCLLGTAVAIPTNARFLPDHSKSTAEPLVMPDNKEIPIVSADAADNEKETTGS
KENHPNHKAEQSSTLRSEEGTHELSAEQDKTQSHELGLKEQDGDDELSVNLEYSTTEGNL
EPQEDTGEPQKKKLQEDTDFSASNVSSLVDSNQQENITKGEGYQEQPGNDSHLQLDKNST
QSQDLREEESQEQDANIPNGKEEEETEPGKADTPTDNPDKEKEFPEDNSNSKQEDNEQPD
DILEEANQPTQVSKMQEDELEQGSQEKEEDNSNVGLEEDSASNISEHTPDTERQSQEGKM
GLKAIGDHKDIDKKTVSEALLLDPTDVNHMTPRNHGADTDNDDSKHSAGDDYFVPSQDFT
EAEKAQSISYHLKYEEERDRAHKNENVDASEPADHQEDKNAQSSSNEEEASSEGHMRAHG
TDSCVNFQCKRGHVCKAEPQGTPHCVCQDPETCPPAKPLDQACGTDNQTYASSCHLFATK
CRLEGTKKGHQLQLDYFGACKSIPVCTDFEVAQFPLRMRDWLKNILMQLYEPNPKHAGYL
NEKQRTKVKKIYLDEKRLLAGDHPIELLLRDFKKNYHMYVYPVHWQFSELDRHPMDRVLT
HSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF
Download sequence
Identical sequences H0UW89
ENSCPOP00000001315 XP_003469421.1.53824 ENSCPOP00000001315 10141.ENSCPOP00000001315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]