SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003470295.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003470295.1.53824
Domain Number 1 Region: 134-171,251-296
Classification Level Classification E-value
Superfamily SET domain 0.00000014
Family Histone lysine methyltransferases 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003470295.1.53824
Sequence length 299
Comment PREDICTED: SET domain-containing protein 9 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MPGRLLRGLWQRWSRYKYRFVPWIALNLSHNPRTLRYVPEESKDKVISDEDVLETLLEVF
QALFLNDLNKQSDILTLLPQSVKSKYQDLLALQHHRVNLLENRHQLQNIFKPEEILYKTL
GFSVARATSSLISAGRGVFVTKGLVPKGAVVSMYPGTVYQKYEPIFFQSIGNPFIFRCLD
GTLIDGNDKGISKVVYRSCSGRDRLGPLKMSDATWLTSEIHNPLAIGQYVNNCSNDRAAN
VCYQEFEVPAVFPIELKQYLPNIAYSYDTQSPLRCVVLVALRDIKQGEELFSNYYTIVS
Download sequence
Identical sequences H0VSE3
ENSCPOP00000013543 10141.ENSCPOP00000013543 ENSCPOP00000013543 XP_003470295.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]