SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003473334.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003473334.1.53824
Domain Number 1 Region: 13-92
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000492
Family Snake venom toxins 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003473334.1.53824
Sequence length 116
Comment PREDICTED: ly-6/neurotoxin-like protein 1 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MAALFTLFFVALAGLPLAQALECHVCAYNGDNCFNPMRCPAMVRYCMTTRTYYTPYRMKV
SKSCVPSCFETVYDGYSKHASTTSCCQYDLCNVAGLAVPGALVFAPILLATIWSLI
Download sequence
Identical sequences A0A286XLH9
10141.ENSCPOP00000003562 XP_003473334.1.53824 ENSCPOP00000003562 ENSCPOP00000003562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]