SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003475668.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003475668.1.53824
Domain Number 1 Region: 232-327
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000054
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003475668.1.53824
Sequence length 612
Comment PREDICTED: UPF0469 protein KIAA0907 homolog isoform X1 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MSAGSATHPGAGGRRSKWDQPAPAPLLFLPPAASGTEVTSSGGSPGAAPAPPSGALDAAA
AVAAKINAMLMAKGKLKPTQNAAEKLQAPGKGLTSNKSKDDLVVAEVEINDVPLTCRNLL
TRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKE
IITNGVVKAATGTSPTFNGATVTVYHQPAPIAQLSPAVSQKPPFQSGMHYVQDKLFVGLE
HAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHP
KSEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPGYSQPSAISSVPPQPPYYPSNGY
QSGYPVVPPPQQPVQPPYGVPSIVPPAVSLAPGVLPALPTGVPPVPTQYPITQVQPPVST
GQSPMSGPFIPAAPIKTALPAGPQPQPQPPLPSQPQSQKRRFTEELPDERESGLLGYQHG
PIHMTNLGTGFSSQNEIEGAGSKPASSSGKERERDRQLMPPPAFPVTGMKTETDERNGSG
TLPGSHDYPAKKMKTTEKGFGLVAYAADSSDEEEEHGGHKNASSFPQGWSLGYQYPSSQP
RAKQQMPFWMAP
Download sequence
Identical sequences H0V451
ENSCPOP00000004383 ENSCPOP00000004383 10141.ENSCPOP00000004383 XP_003475668.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]