SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003478354.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003478354.1.53824
Domain Number 1 Region: 789-906
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.33e-35
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Weak hits

Sequence:  XP_003478354.1.53824
Domain Number - Region: 62-159
Classification Level Classification E-value
Superfamily CoA-transferase family III (CaiB/BaiF) 0.0314
Family CoA-transferase family III (CaiB/BaiF) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003478354.1.53824
Sequence length 917
Comment PREDICTED: smoothelin isoform X4 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MADEALAGLDEGALRKLLEVTSDLAERRRIRSAIRELQRQELEREEEALASKRFRAERQD
NKENWLHSQHREAEQRAALAQLAKQLESMNDVEELTTLLRSAGEYEERKLIRAAIRRVRA
QEIEAATVAGRLCSGRPNSSSREESKEQAAHRLEQCEVPEHKEQEQQTEVSEPTPTPEDT
SQDVTTVTLLLRPPPGDTPSSTASPDNSPSTASPEPPLELAGAQCAAAEAPGDPEPPPRT
PRTPTPELPESLAQPNMERQAANKLLPGSTEPPAAQSPTRGPSNKNRADLAGPQPCQRSL
SVLSPRQPTQNQESTPLGIGHSPFHRAGSVRDRVRKFASDSPMAARLHDGPTRATLGSPT
PTRLLGSSVIISTTPASSSRSSSSRGPSNTSSESSKEQRGTTQPLAQLQSCPQEEGPRGR
GLAARSLENRAGEPVACSEEPSAPLPVAVSAAEPGGSMKTTFTIEIKDGRGQASTGRVLL
PTSNQRAELTLGLRTPPTLLNTGSGNKSTITHVSSPGTLTRMGGVTQVTTFSHASPGSRR
GCSTKMEPEPVQPPFTAVEAANGAEKTQVDKAPQGQSPLSTEELMAIEDEGVLDKMLDQS
TDFEERKRIRAALRELRQRKRDQRDKEREQRLQEARGRPGERRSNTSTEMTTTHSQRAAD
GSAVSTVTKTERLVQSNDGTRTARTTTVESSFVRRSENGSGSTTVQTKTFSSSSSSSKKM
GSIFDREDQASPRSGSLAALEKRQAEKKKELMKAQSLPKTSASQARKAMIEKLEKEGTSG
SPGGPRTGVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALV
HNFFPEAFDYGQLSPQNRRQNFEVAFSSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQ
EFYRCLVQKGLVKTKKS
Download sequence
Identical sequences H0VL97
XP_003478354.1.53824 ENSCPOP00000011124 10141.ENSCPOP00000011124 ENSCPOP00000011124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]