SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003500967.1.69978 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003500967.1.69978
Domain Number 1 Region: 244-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-31
Family Laminin G-like module 0.085
Further Details:      
 
Domain Number 2 Region: 684-829
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000939
Family Reprolysin-like 0.078
Further Details:      
 
Domain Number 3 Region: 1521-1595
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 1587-1644
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00001
Family Complement control module/SCR domain 0.0069
Further Details:      
 
Domain Number 5 Region: 1477-1527
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000011
Family Complement control module/SCR domain 0.0066
Further Details:      
 
Domain Number 6 Region: 545-631,720-772
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000586
Family Reprolysin-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003500967.1.69978
Sequence length 1788
Comment PREDICTED: pappalysin-2 isoform X1 [Cricetulus griseus]; AA=GCF_000223135.1; RF=representative genome; TAX=10029; STAX=10029; NAME=Cricetulus griseus; AL=Scaffold; RT=Major
Sequence
MMCWKVLRVSLVVLAGWAFSTTSSELGWTRKKFLAQRGQLNQVLLEGEHCWLGIKIRRPR
TAPQHHLFGVYPSRPESYLRPYAVGKKRTSYAGASQPGMERQAPSVVPGDLTENPAEVRR
ESEQPAALWVGDGPIGQSELLRDDDTYLGNGGSKEALGKPATRGSSEAAVSTITTFAYQK
RPTEETRRKHQAKSRLPRHVLKRPAEDMTRDPQNAPPDFQLLPKDPLKHGNSDGPLEGTI
QNGGGASASGLETFNPQGGLPVLYFSGKRERLLLRPEVLAEIPREAFTVEAWVRSEGGQN
NPAIIAGVFDNCSHTANDKGWALGIRSGKEKGRRDARFFFSLRTDRVKKATTVTGHSRYQ
PGTWAHVAATYDGQHIALYVDGTRVASSPDQSGPLNSPFMSSCRSLLLGGDSSEDGHYFR
GYLGTLVIWSTALSQAHLQHSSQHPSRADELSTLILTATFDPLKEQWAPFRDETYPRLEV
LQDSDSQPEIRSPLQPPLCGQTACDNVELISQYNEHGPLRGEKVIRYQVVKICDDEGLHP
IVSDEQIRRQHDALNKAFSRYNISWQLSVHPVHNSTLRHRVVLVNCEPSKIGNDHCDPEC
EHPLTGYDGGDCRLQGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPAVTDVRKTCFDPD
SPKRAYMSVKELKEALQLNSTHFLNVYFASSVGEDLAGAATWPWEKEAVSHLGGVVLNPA
YYGMPGHTNTMIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMETGDLCADTAPTPKS
KLCRDPEPANDTCGFIHFPGAPFNNYMSYTDDECTDSFTPNQVARMHCYLDLVYQQWSES
RKPTPIPIPPMVIGQTQKSLTIHWLPPISGVVYDRTPGSMCEACTEDGTFHQYVYKASSG
RVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPAEGCSLELLFQHP
VQADTLTLWVTYLSMNSSKALFDIEILLELKESVHLGPFNTFCDTPLTIKLHVDGKVLGV
KVYTFDERMEIDAALLTSRPHSSFCSGCRPVSYRVLREPPFSTGLPMVVTHPHRKFTDME
VTPGQMYKYQVQAEAGGEFGEASPPLSHIHGSPYCGDGKVERSMGETCDDGDLLNGDGCS
GVCQLEEGFNCVGEPSLCYRHEGDGICEPFEKETSIIDCGLHAPEGHLDQWATQAYSYHE
DKKKCPVSLVTGEPHSMICTSHHPESSPNRLFLGWFPCVFSLKTAPEEGSEKSEDSLQKD
NEIWLEVCFDRPGVAEAIFLFLASDGLAPGKRQQSTVTLYLVDVSGSNHSVGTYELSCQH
NPLVINVSHHVNVCPHHTSSMLLNFSSPLVGISAVALRTSSHTSSSVTSNCIPEQNHQGQ
SCAQRPCGEQGRCTPLLLDHADMVNCTSSGPGHMKCAITCQRGYVLQTSSGQYIRTMQKG
ILLTCSSGHWDKDVSCVHVDCGVPDSSLVNYANFSCLEGTDFQKRCSISCVPPAKLQGLS
PWLTCLEDGLWSLPEVYCKLECDAPPVIPNANLLLPNCLEGNHDVGTICRYECKPGYYVM
ESTGSQSRNKFLKIQCLDDGTWEQRSCIPVVCEPPSPVFEGMYECTNGFMLDSQCVLNCN
QETERTPILCTKEGLWTQEFKLCENLQGECPPPPSELNFVEYKCGQGYGIGAVCSPTCVV
PPSDPVMLPENVTTDTLEHWMEPVKVQSIVCTGRRQWHPDPSLVYCIQSCEPFQADGWCD
TINNRAYCHYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENQ
Download sequence
Identical sequences G3HA04
XP_003500967.1.69978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]