SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003509116.1.69978 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003509116.1.69978
Domain Number 1 Region: 287-383
Classification Level Classification E-value
Superfamily Immunoglobulin 7.13e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 446-737
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00000000000000144
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.049
Further Details:      
 
Domain Number 3 Region: 28-85
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000402
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 210-299
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000142
Family I set domains 0.081
Further Details:      
 
Domain Number 5 Region: 131-198
Classification Level Classification E-value
Superfamily EF-hand 0.0000000014
Family Calmodulin-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003509116.1.69978
Sequence length 799
Comment PREDICTED: follistatin-related protein 5 isoform X1 [Cricetulus griseus]; AA=GCF_000223135.1; RF=representative genome; TAX=10029; STAX=10029; NAME=Cricetulus griseus; AL=Scaffold; RT=Major
Sequence
MVFGHGFLIQDSPFGSCENKFCGLGRHCVISRETRHAECACMDVCKQHYKPVCGSDGEFY
ENHCEVHRAACLKKQKITIVHNEDCFFKGDNCLATEYSKMKSMLLDLQNQKYITQENENS
NGDDISRKKLLVDQMFKHFDADSNGLVDINELTQVIKQEELNKDFSDCTLYDLLKYDDFN
ADKHLALEEFYRTFQVIQLSLPEDQRVSITAATVGQSAVLSCAIVGALRPPIIWKRNNIV
LNNLDLEDINDFGDDGSLYITKVTTVHMGNYTCYADGYEHVHQTHIFQVNVPPVIRVYPE
SQAREPGVTASLRCHAEGIPDPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDT
GAYTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPT
ECEFQRHIKPSEKLLGFQDEVCPKDEEDEVQRCVWASAVNVKDKFIYVAQPTLDRILIVD
VQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGSMEKTSPTLQVITLASGNMPHHTIHT
QPVGKQFDRVDDFFIPTTTLIITHMRFGFILHKDEAALHKIDLETMSYIKTINLKDSKCI
PLSLAYTHLGGYYFISCKPDVTGALPPQLVVDSVTDSVIGFNSDVTGTPYISPDGHYLVS
VNDVKGLVRVQYITIRGEILDAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSGQQTDVLF
VELSSGKVKMIKSLKEPLKTEDWPWSRKNRHIQGSGLFGQYLMTPSKDSLFILDGRLNKL
NCEITEVQKGNTVVWVGDA
Download sequence
Identical sequences XP_003509116.1.69978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]