SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003578089.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003578089.1.954
Domain Number 1 Region: 159-315
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.25e-31
Family Thioltransferase 0.00056
Further Details:      
 
Domain Number 2 Region: 44-152
Classification Level Classification E-value
Superfamily TPR-like 1.21e-23
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003578089.1.954
Sequence length 319
Comment PREDICTED: TPR repeat-containing thioredoxin TDX [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MEKVGENSFEDEIMESDIELEGEVFEPDNDPPQKMGDPSVEVSDENRDKAQLYKKEGLDA
LSEGKLIEAVECLTDGILLNPTSAILYATRAGVFMKMKKPNAAIRDADAALQINPDSAKG
YKSRGMAKAMLGKWEDAAHDLHLAAKLDFDEEICSELKKVEPNVHKIEEHRKKYERLRKE
REVKKADMERQRKQAEEVSAASAVVKDGEVITVHSSNELETKLKAASSLSRLVILYFTAT
WCGPCRLMGPVYKSLAEAHRNVVFLKVDIDELGIVAHRWNVSSVPTFSCVINGKEIDKVV
GADKASLERKIAQHGSSKK
Download sequence
Identical sequences I1IPZ3
XP_003578089.1.954 XP_010238150.1.954 EG:BRADI4G29820.1 15368.BRADI4G29820.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]