SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003591512.2.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003591512.2.50012
Domain Number 1 Region: 97-279
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.94e-60
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000246
Further Details:      
 
Domain Number 2 Region: 25-95
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 0.0000000000000017
Family Domain of poly(ADP-ribose) polymerase 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003591512.2.50012
Sequence length 291
Comment poly [ADP-ribose] polymerase [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MLVHHVYMNFSSTISFHYNWIAIFNNWLWVCCREFYTIIPHDFGFKNMREFVIDTPQKLI
HKLEMVEALAEIEVATKLLKDDAEMQGDPLYAYYKCLRCELVPVESGTEEFSMIESYMMN
THAKLHSDYTVEIVQIFRTSKEGEAERFRKFSNTKNRMLLWHGSRLTNWTGILSQGLRIA
PPEAPVTGYMFGKGVYFADMFSKSANYCHPTPTAADGVLLLCEVALGEMAELLTGDHDAD
RLPEGKLSTKGVGATAPDFSKAQELEDGLIVPLGKPKTNSRIKLQGNLIAQ
Download sequence
Identical sequences G7IF44
XP_003591512.2.50012 Medtr1g088400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]