SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003598699.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003598699.1.50012
Domain Number 1 Region: 486-772
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-79
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 75-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.4e-28
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Weak hits

Sequence:  XP_003598699.1.50012
Domain Number - Region: 346-407
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00667
Family Anti-platelet protein 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003598699.1.50012
Sequence length 821
Comment S-locus lectin kinase family protein [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MEKHNKLIMLMVCTFLFCFMPTFSKLNTLTPNLFIQYNETLVSAAGTFEAGFFNFGDPQR
QYFGIWYKNISPRTIVWVANRNTPVQNSTAMLKLNDQGSLVILDGSKGVIWNTNSSRIVA
VKSVVVQLLDSGNLVVKDADSTQNFLWESFDYPGNTFLAGMKLKSNLVTGPYRYLTSWRN
PDDPAEGECSYKIDTHGFPQLLTAKGAIILYRAGSWNGFLFTGVSWQRMHRVLNFSVMFT
DKEISYEYETLNSSIITRVVLDPNGLSQRLQWTDRTQNWEALANRPADQCDAYAFCGINS
NCNINDFPICECLEGFMPKFQPKWESSDWSGGCVRKTHLNCLHGDGFLPYTNMKLPDTSA
SWFDKTLSLEECKTMCLKNCTCNAYATLDIRDDGSGCILWFHNIVDMRKHQDQGQDIYIR
MASSELDHKKNKQKLKLAGTLAGVIAFTIGLIVLVLVTSAYKKKIGYIKKLFLWKHKKEK
EDGELATIFDFSTITNATNNFSVRNKLGEGGFGPVYKAVLVDGQEIAVKRLSKTSGQGTE
EFKNEVKLMATLQHRNLVKLLGCSIQQDEKLLIYEFMPNRSLDCFIFDTTRSKLLDWTKR
LEIIDGIARGLLYLHQDSTLRIIHRDLKTSNILLDIHMIPKISDFGLARSFMGDQAEANT
NRVMGTYGYMPPEYAVHGSFSIKSDVFSFGVVVLEIISGRKNRGFCDPLHHRNLLGHAWR
LWIEGRPEELIADMLYDEAICSEIIRFIHVGLLCVQQKPENRPNMSSVVFMLKGEKLLPK
PSEPGFYGGSDNNINNNTISTGSSSKGCSVNEASISLLEAR
Download sequence
Identical sequences G7IYX6
Medtr3g019420.1 Medtr3g019420.2 XP_003598699.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]