SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003611482.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003611482.1.50012
Domain Number 1 Region: 16-209,355-437
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.29e-34
Family Bacterial dinuclear zinc exopeptidases 0.0049
Further Details:      
 
Domain Number 2 Region: 210-320
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 2.09e-16
Family Bacterial exopeptidase dimerisation domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003611482.1.50012
Sequence length 439
Comment M20 peptidase acetylornithine deacetylase [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
mttptknlletlgnlekdsfiplltnligesrhvqnnppelipeedrvvkhvlnsllpls
tttgggpliinhvtyfpgrgnliveypgtvpgkilsfvgchmdvvtanpndwdfdpftls
idgdklkgrgttdclghvalvtelmkklgetkpnlkstvvavfianeensaitgvgvdal
vqdgllnklkegplfwidtadkqpcvgtggmipwklhvtgkmfhsglahkainplelamd
aikeiqlkfyndfpphpqeqvygfatpstmkptqwsypggginqipgectisgdvrltpf
ynvkdvmkklqeyvdeinenihklesrgpvskyalsdenlrgsltltfdeansgvacnld
srgfhvlckateeivghvkpfsitgslplirelkdegfdvqccgyglmatyhaqneyclf
tdmcqgyrvfasiiaqled
Download sequence
Identical sequences G7JZY6
XP_003611482.1.50012 Medtr5g014410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]