SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003639794.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003639794.1.84170
Domain Number 1 Region: 2209-2302
Classification Level Classification E-value
Superfamily C-type lectin-like 1.88e-32
Family Link domain 0.0001
Further Details:      
 
Domain Number 2 Region: 509-647
Classification Level Classification E-value
Superfamily FAS1 domain 8.63e-30
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1473-1521,1599-1713
Classification Level Classification E-value
Superfamily FAS1 domain 1.2e-28
Family FAS1 domain 0.0023
Further Details:      
 
Domain Number 4 Region: 1713-1868
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-26
Family FAS1 domain 0.0038
Further Details:      
 
Domain Number 5 Region: 965-1122
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-23
Family FAS1 domain 0.0039
Further Details:      
 
Domain Number 6 Region: 386-501
Classification Level Classification E-value
Superfamily FAS1 domain 6.02e-20
Family FAS1 domain 0.0071
Further Details:      
 
Domain Number 7 Region: 2300-2462
Classification Level Classification E-value
Superfamily FAS1 domain 2.22e-16
Family FAS1 domain 0.011
Further Details:      
 
Domain Number 8 Region: 1131-1254
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000017
Family FAS1 domain 0.0072
Further Details:      
 
Domain Number 9 Region: 1544-1582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000023
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003639794.1.84170
Sequence length 2572
Comment PREDICTED: stabilin-1 isoform X2 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MAGPRGLLLLCLLAFCLAGSHFTRGQKVRSRRCDVKTKFVTHLPCTVCPAIKRRMCPAGW
LRELPEKILRDCSYEVQLGDSLMSMRGCSLECWKDVVEKACCPGYWGSQCYECPGGAETP
CNGHGTCLDGIDGNGTCVCQQNFSGSACQECQDPKWFGPNCQSVCSCVHGVCSHGPLGDG
SCLCFAGYTGPRCDQELPVCQALNCPQNSQCSAEAPACSCLPGHTQQGRECQAPNPCRPS
PCSPLAQCSVSPTGQAQCRCPKNYYGDGMVCLPQDPCTINYGGCPRNSTLCLYQRPGKAS
CLCKPGLVSINHNASAGCFAYCFPDSCDRSATCQLTPDGKTSCVCKEGEVGDGRACYGHL
LHEIQKAGQLGLVLLRLKVSLAMLDQGCREILSTSGPFTVLVPWLSSTSSRTMNVSFARQ
LCKQHIIAGQHVLEEPGSQQTRRWWTLAGQEITVTYNRFMKYTYKYKEHPKQTFTIHKAN
YPAANGVFHLVTALQWQPPPELPEDPKRTIGQILASTEAFSRFETILENCGLPSILDGPG
PFTVFAPSNEAVDKLRDGRLIYLFTAGLSKLQELVKYHIYSHGQLTIEKLISKGRVLTMA
NQVLAVNISEEGRILLGPDGAPLRRVDVLAANGVIHMLEGILLPPTILPILPKHCSEEKH
EMVAGSCVDCQALNTSTCPPNSIKLDIFPKECVYTHDPTGLNVLKKGCASYCNQTILKPG
CCKGFFGPDCAQCPGGFSNPCYGKGNCSDGVQGNGACLCFPDYKGIACHICSNPNKHGDR
CQEDCGCVHGLCDNRPGSGGVCQHGTCAPGFSGRFCNESTGNCGPSEQAQNCHPHARCVR
QGGVARCVCLDGFEGDGFSCTPSNPCSRPGRGGCSENAECVPGAPGTHHCTCNKGWSGDG
RVCVAIDECELDARGGCHADALCSYVGPGQSRCTCKLGFAGDGYVCSPIDPCRAGNGGCH
DLATCRPVGGGQRVCTCPSGYGGDGFSCYGDIFRELEANAHFSVFYQWIKSAGLTLPTGS
RVTALVPSESAIRRLSPEDQAFWLQPRALPQLVRAHFLQGAFSEEELAQLGGQDVATLSP
TTRWEIHNISGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRGSVPQGQGLLQQLDLVP
AFRLFRELLQHHKLVSQIEAATAYTIFVPTNRSLEAQGNSSSLDADTVRHHVILGEALSH
EALQKGGHRNSLLGPAHWLVFYNHSGQPEVNHVLLEGPMLEAPGRSLFGLSGVLTVGSSR
CLHSHAESLREKCVNCSRRFRCSQGFQLQNTPKKSCIYRSGYSFSRGCSYTCAKKIQVPD
CCPGFFGTLCEPCPGGQGGVCSGHGQCQDRLLGSGECRCHEGFHGTACEMCELGRYGPTC
AGVCDCAHGLCQEGLQGDGSCVCNVGWQGPRCDQNITAPQCPMKCDPNANCVQDSAAAPA
CVCAAGYSGNGINCSEVDPCAHDHGGCSPHANCTKVAPGQRTCTCQDGYTGDGELCQEVN
NCLIHHGGCHMHADCISTGPQQVSCSCREGYSGDGIRTCELLNPCSQNNGGCSPYAVCKS
TGDGQRTCTCDAAHTVGDGFTCRARVGLELLRDRHASFFSLHLLEYKELKGDGPFTVFVP
RADLMTNLSQDELARIRAHHQLVFRYHVVGCRQLSVQELLEEGYVTTLSGHPLRIHEREG
SVYLNDFARVVSSDHEAVNGVLHFIDQVLLPPDVLHWEPDAAPVVRKNVTVAAESFGYKI
FSGLVKMAGLLPLLQDASHRPLTMLWPTDAALQALPPDRQDWLYHEDHRDKLAAILRGHV
IRNIEALASDLPNLGPLRTMHGTPISFSCSRARPGELTVGEEDAHIVQRHLLFEGGVAYG
IDQLLEPPGLGARCDRFETRPLRLKFCSICGLEPPCPEGSQEQGSPEACWRYYSKFWTSP
PLHSLALRSIWARSSLWGQPQGLSRGCHRNCVTTTWKPSCCPGHYGSECRACPGGASIPC
SGHGVCMDGMSGSGQCQCHSRFTGTACELCASGAFGPQCQACHCTSHGRCDEGLGGSGSC
FCDEGWTGPSCEVQLKLQPVCAPPCAPQARCRADNSCECGLGYEGDGRTCTVVDLCRYWH
GGCSQHANCSQVGTVVTCTCLPDYEGDGWSCRARDPCADGRRGGCSEHADCLSTGPNTRR
CVCHAGYVGDGLQCVEEPEPPVDRCLGQPPPCHVDAVCTDLHFQEKQAGVFHLQAPSGRY
GLNFSEAEAACAAQGAVLASLPQLSAAQKLGFHLCLLGWLANGSAAHPVVFPAADCGGGQ
VGVVSLGIRKNRSECWDAYCYREQDVACRCRHGFVGDGMSMCNGKLLDVLAATANFSTFY
GMLLGYANATPRGLDFLDFLDDELTYKTLFVPVNEGFLDNMTLSGPDLELHASNTTFLST
NASQDTVLLAHSGLSLVFSAVGPDNSSWAPVAPGAVVVSHVVVWDIMAFNGIIHALARPL
LAPLQPRAVVAPEAPPVMAGVGAVVAAGALLGLVAGAFYLRARGKATGFGFSTFQAEDDA
EEDFSPWQEGTSPTLVSVPNPVFGSHDAFCEPFDDSLLEDDFPDTQRILAVK
Download sequence
Identical sequences XP_003639794.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]