SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003643006.2.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003643006.2.86415
Domain Number 1 Region: 77-196
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000328
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003643006.2.86415
Sequence length 345
Comment PREDICTED: corticotropin-releasing factor-binding protein [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MPRRLLPAGSEQQVLSAHGGAATMPSAFQLQCHLVLILLAASKGDTRYLEVRDAGEDEPF
LLLSEDLKRELSAGHIYRRSLRCIDMLSIEGQFTFTADQPQLHCATFFIGEPEELLTIEY
DFVNIDCQGGDFLKVFDGWILKGEKFPSSLDHPLPTSQRYTDFCESGAVQRSIRSSQNVA
MIFFRIHQPGNGFTITVKKSANLFPCNVISQTPSGRFTMVIPHQHRNCSFSIIYPVVIKI
SDLILGHLNGLFLKNPSVGCAGVGDFVELLGGTGLDPSKMFPLADLCHSFHGSAQMKIGC
DNTVLRMVSSGKHINRVTFEYYQLDLQEIENRKENSIEEFCFPGI
Download sequence
Identical sequences E1C1R3
XP_003643006.2.86415 ENSGALP00000024136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]