SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003678949.1.64532 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003678949.1.64532
Domain Number 1 Region: 210-347
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000085
Family Glutathione peroxidase-like 0.069
Further Details:      
 
Domain Number 2 Region: 431-476,540-570
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000121
Family UBX domain 0.031
Further Details:      
 
Weak hits

Sequence:  XP_003678949.1.64532
Domain Number - Region: 14-59
Classification Level Classification E-value
Superfamily UBA-like 0.00663
Family TAP-C domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003678949.1.64532
Sequence length 604
Comment hypothetical protein TDEL_0A04060 [Torulaspora delbrueckii]; AA=GCF_000243375.1; RF=representative genome; TAX=4950; STAX=4950; NAME=Torulaspora delbrueckii; strain=type strain:CBS 1146; AL=Chromosome; RT=Major
Sequence
MPIIEHNGQVFHLSHEEREKLDEFRVITDFPQDDLPLIIRLLQNYGWHLERALSFYFDGD
WKSSIIAQELPAIPNRPPTPATFPPIPERSPFIASDAHLIPSLRVVKPLPSNFREVFSVV
GLNKNNGDVWNMNPQHSPLIIILMFIPRLLVKLGVSVLSLLWGLITFGFNSHLDERTNVR
KVPSRPKEKQPPFDQLISPLIDGQGLERLNKLMSTQSFNEALKICQDEFKYLLIVFIGDV
SDEEDPDVNSQRFISKVLSNPTVLSMLESYKDELIIYLGSVHELETWLVAQDLRIKYVPE
CLLVGNVLNSKGSVNGVTRLSVLSKLRISSAKKFENSLKVTIEKFQPELVVSRTEQAEIL
LAREIKKLQDDAYQNSLEQDRVKAEERKMKEEEALLELNNKTQREKDKKIKETVKHLQWL
RSCADFMKKEPATSGVGTVATLQIRTSKGLRLVKEFSSTTSLHSLYVKIGCHLYLDTNSK
DQEELSKIIADKLQSLAEDDSVLCFKDREVLKDELKAENLTKAIELELKKWKDEMSSDLE
FDFELVSPFPREKIPVDKEMTVKEVTQLWPKGSLLVEELVEDDEDDEDDDEDDEDEESME
SGSE
Download sequence
Identical sequences G8ZM94
XP_003678949.1.64532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]