SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003720179.1.18062 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003720179.1.18062
Domain Number 1 Region: 380-619
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000012
Family Phospholipase D 0.011
Further Details:      
 
Domain Number 2 Region: 231-302
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000722
Family Phospholipase D 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003720179.1.18062
Sequence length 627
Comment hypothetical protein MGG_09426 [Magnaporthe oryzae 70-15]; AA=GCF_000002495.2; RF=representative genome; TAX=242507; STAX=318829; NAME=Magnaporthe oryzae 70-15; strain=70-15; AL=Chromosome; RT=Major
Sequence
MALAGLLSFVESLDPRGELLGLSYSLTNNVQLGYGDGVSSAFQFIPYGTWENYDQPQDQI
PSVLEQAFAETIVQGHRINGQPDTQYSFIDILQLQQPYPLFFTEPLLEGPDQGKSLVEVL
ADTVNSIDPDVTPVIRYIVGNPTPPPTGPSPAEYVEAFWPQASNESIFTHPKAVLYVGSF
NPDIELAQDLGQVVDRWIKALVSNVGGGALISKVITSVANAIIGSSVGGLIPPVTWNHAK
IVAVNGRALLTGGGNYFDLYASGQDSLIDSDITILGDAAVSGHRYADYLWKYLNSNHLGY
DNASQAWSTLLADPAPRHGIPLARQPAPMFPAATPRLKGDVPVLAMSKIGNFNPAGAIEY
PAQVITAIRDVFYQLVWAKTPSWLPLVAELTSDARLDSAFEDVGVNPATWASRAARAQAV
SQAQDYVILSQAMLVNWVMVPETAWQKLVAKINDDMNIGWDGKIWPFDLLISIAQAIINI
EQNHKDDPDPTKAVFIMVSLLASPTDPAPQGYQDTTTIADLTSRVAAILKSVGNLSKDEA
SDMMARRFHVKRSVLNPPAGSGGSAAVKKLHTKVVDVDGKLMYTGSDNAYPQWNEQFGVW
IEDVDGIKAWEDGFFWGFWERAVNSVM
Download sequence
Identical sequences G4NHV2
MGG_09426T0 XP_003720179.1.18062 148305.A4R3U8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]