SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003731021.1.5271 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003731021.1.5271
Domain Number 1 Region: 156-448
Classification Level Classification E-value
Superfamily L domain-like 6.35e-43
Family Internalin LRR domain 0.045
Further Details:      
 
Domain Number 2 Region: 553-696
Classification Level Classification E-value
Superfamily L domain-like 2.38e-29
Family Ngr ectodomain-like 0.0034
Further Details:      
 
Domain Number 3 Region: 780-920
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-28
Family Toll/Interleukin receptor TIR domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003731021.1.5271
Sequence length 934
Comment PREDICTED: slit homolog 3 protein-like [Strongylocentrotus purpuratus]; AA=GCF_000002235.4; RF=representative genome; TAX=7668; STAX=7668; NAME=Strongylocentrotus purpuratus; AL=Scaffold; RT=Major
Sequence
MATEVHSTKTRLCLCVFGVLLSMIPATFSLSCNVPDLPCLCEGPTQGSGDHIEYHRITCF
LTGEWNVTIGVIPLTRSLILSCSHGGNGTEEPADLKEDLFHKFAGVLQNLTMRRCKIGNL
PTEIFTDLILLQRLLLTSVDLNGERLSAIGGIKTNASVKLYSNKLHSLNSDSFGNYFSNV
SSLDLYSNSVQEIGNGTFAMFPSLRKLFLGNNTISVVKEGAFSGLQRLSELNVRGNPSMF
DGSWCLFKNVPFLTTLDVSFTGLTNATQFNCAPLVHLRRLLIHDNNLTKLDGSVFALMPN
ITFIDVSNNDLEYIHSSAFHGGLNGLNHVDMSGNHLRDFPILAFESTPNIKSINISYNYL
RVIKKGTFSGQASLQTIDLSFNRLHTIDMFGFVALDNLTMIDLRHNNFAIFPENVVWPFD
IQPPHIPIKTFLQGNNFNCGCHWMFYIRRGEFKDTYPFFILSDNSTWTCKAPSPVANKPM
MTLPLEDFWCPYYNDEACRRGSCECYSRDVDEANVFFCNNNTMHSLPNFPANTFMFECDG
CLIDDQVTLQVGAFQASARLTFLVLQDIGLERILPGALQEFPNLQQLDVSYNVLNTFSDD
IITNLTHLHTVDLSNNRVNSLNSNTFATNLNLTTVKLHSNNLKTLEDGVFNSTTYLEVLT
LHNNPFVCNCSLFWLKQWLQSHLDVVPQLYDVKCYVNSSNPDLYPIIQVADLDFGCYNPD
VLTVQEYNAVIVTSTLTLLFLMVGAVTFRHRRAIRVILYTRYGFHVLHDDDDDDVVLDNV
RWEYDAYIAYSDEDIQFVLENIIPILEDDDNLRYKLCVRHRDFPPGGCIATTIVTSLEAS
RRSIVLISRSFLQDEWRLLEFKTAHQRVLKDKRNKNLILVFLEDLTKDEMDDDMRYYVTA
NAYLSTTDRLFRENLLYEMPRRPLGEIHGDVDER
Download sequence
Identical sequences XP_003731021.1.5271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]