SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003731873.1.5271 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003731873.1.5271
Domain Number 1 Region: 124-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000407
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 5-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000527
Family EGF-type module 0.029
Further Details:      
 
Domain Number 3 Region: 85-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000455
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 44-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000231
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003731873.1.5271
Sequence length 163
Comment PREDICTED: fibropellin-3 [Strongylocentrotus purpuratus]; AA=GCF_000002235.4; RF=representative genome; TAX=7668; STAX=7668; NAME=Strongylocentrotus purpuratus; AL=Scaffold; RT=Major
Sequence
MCQNSKSCLLDPCQNGGACSQVTNTLHTCSCSSQFTGNRCQYNDPCRVTPCLNAGVCTLT
FDGSNRVCSCVNSWTSDDCSIAGGCNPTTPCMSGGTCVHDISTGSFVRCDCLPGYVGSFC
QDRLACQNGPCLNGGACVDDATTLTYTCNCLSTYVGMNCQYRK
Download sequence
Identical sequences XP_003731873.1.5271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]