SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003750560.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003750560.1.100692
Domain Number 1 Region: 54-229
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 6.28e-59
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003750560.1.100692
Sequence length 242
Comment PREDICTED: phosphopantothenoylcysteine decarboxylase isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MIPAQDHTPDQENSPGQDLDSCFTGQILLSSQKATRSRMEPEAPCPASIPSVERKFHVLV
GVTGSVAALKLPLLVSKLLDIPGLEVTVVTTERAKHFYSPQDVPVTLYSDADEWEMWKRR
SDPVLHIDLRRWADLMVVAPLDANTLGKVASGICDNLLTCVIRAWDLNKPLLFCPAMNTA
MWEHPLTAQQVGQLKAFGYVEIPCVSKKLVCGDQGLGAMAEVEIIVAKVKDVLFQHGGIQ
QS
Download sequence
Identical sequences D3ZZZ5
ENSRNOP00000025289 ENSRNOP00000025289 10116.ENSRNOP00000025289 NP_001102233.1.100692 XP_003750560.1.100692 XP_008764526.1.100692 XP_008764527.1.100692 XP_008764528.1.100692 XP_017459124.1.4139 XP_017459125.1.4139 XP_017459126.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]