SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003755438.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003755438.1.9362
Domain Number 1 Region: 71-126
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000752
Family Tudor domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003755438.1.9362
Sequence length 238
Comment PREDICTED: survival of motor neuron-related-splicing factor 30 isoform X1 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLAS
SDSFASAQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLL
NLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQ
FNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Download sequence
Identical sequences F6ZET6 G3WR38
XP_001368587.1.35504 XP_003755438.1.9362 XP_020843658.1.61212 XP_020843659.1.61212 ENSMODP00000013212 ENSSHAP00000017893 ENSSHAP00000017892 13616.ENSMODP00000013212 ENSMODP00000013212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]