SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003756180.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003756180.1.9362
Domain Number 1 Region: 136-254
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 240-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000503
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 3 Region: 15-70,108-162
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000105
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003756180.1.9362
Sequence length 444
Comment PREDICTED: fibulin-5 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MPGLKRILTVSILTLCLTSPGYAQQQCTNGFDLDRASGQCLDVDECRTIPDACRGDMMCV
NQNGGYLCIPRTNPVYRGPYSNPYSGAYPPPPAPVPAPNYPTIARPVICRFGYQMDEGNQ
CVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANV
PGSYSCTCNPGFTLNEDGRSCQDVNECMTENPCVQSCLNTFGSFICRCDPGYELEDDGVH
CSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHQNHTCILQQT
CYNLQGGFKCIDPIRCEEPYLQISDNRCMCPAENPGCREQPFTILYRDMDVVSGRSVPAD
IFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPRDIQLDLEMIT
VNTVINFRGSSVIRLRIYVSQHPF
Download sequence
Identical sequences G3W1X0
ENSSHAP00000009425 XP_003756180.1.9362 ENSSHAP00000009425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]